SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q08048 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q08048
Domain Number 1 Region: 486-723
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.19e-58
Family Eukaryotic proteases 0.000000011
Further Details:      
 
Domain Number 2 Region: 116-214
Classification Level Classification E-value
Superfamily Kringle-like 2.13e-35
Family Kringle modules 0.00000629
Further Details:      
 
Domain Number 3 Region: 211-294
Classification Level Classification E-value
Superfamily Kringle-like 1.35e-33
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 4 Region: 303-386
Classification Level Classification E-value
Superfamily Kringle-like 1.69e-31
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 5 Region: 382-478
Classification Level Classification E-value
Superfamily Kringle-like 1.04e-28
Family Kringle modules 0.0004
Further Details:      
 
Domain Number 6 Region: 37-126
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 5.89e-22
Family Hairpin loop containing domain 0.00000997
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q08048
Sequence length 728
Comment (sp|Q08048|HGF_MOUSE) Hepatocyte growth factor beta chain KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Hgf; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MMWGTKLLPVLLLQHVLLHLLLLHVAIPYAEGQKKRRNTLHEFKKSAKTTLTKEDPLLKI
KTKKVNSADECANRCIRNRGFTFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLY
ENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRN
PRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQT
PHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVP
METTECIQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDG
AESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNM
EDLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVN
LDHPVISCAKTKQLRVVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPAR
NKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTI
DLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESEL
CAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIH
KVILTYKL
Download sequence
Identical sequences Q08048
ENSMUSP00000030683 NP_001276387.1.92730 NP_001276388.1.92730 NP_034557.3.92730 ENSMUSP00000030683 ENSMUSP00000030683 10090.ENSMUSP00000030683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]