SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q0A6H6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0A6H6
Domain Number 1 Region: 11-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.28e-16
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q0A6H6
Sequence length 109
Comment (tr|Q0A6H6|Q0A6H6_ALKEH) Anti-sigma-factor antagonist {ECO:0000313|EMBL:ABI57561.1} KW=Complete proteome; Reference proteome OX=187272 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1). GN=Mlg_2219 OC=Ectothiorhodospiraceae; Alkalilimnicola.
Sequence
MSRAGGKQAQLESTGEAGRFQLSGDLSFETVPGLWAEAERLFRGSGDVELDLGAVARTDS
AGLALLVALTRRAAQHDQAIRFCHFPEQLRAMARLSGLADFLQLAPEKA
Download sequence
Identical sequences Q0A6H6
WP_011629955.1.71132 gi|114321368|ref|YP_743051.1| 2005452293 187272.Mlg_2219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]