SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q0AN41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0AN41
Domain Number 1 Region: 14-105
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000255
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q0AN41
Sequence length 384
Comment (tr|Q0AN41|Q0AN41_MARMM) Uncharacterized protein {ECO:0000313|EMBL:ABI66296.1} KW=Complete proteome; Reference proteome OX=394221 OS=Maricaulis maris (strain MCS10). GN=Mmar10_2004 OC=Hyphomonadaceae; Maricaulis.
Sequence
MRGMRDESPARAELVVREEGERTILEPHGDWVIDTIGRHDNAIRAVEASADPCSIVVDVS
HLGRVDTAGAYLLGRATRKCPTPDADFHFVGQHRTVRRLIEEVRMRTQVCGPDEVPTFGF
IKALARLGAGIEVAYQEAVDTFAFFGKTLTTGLSCFIQPWRFRLTPTVWAMEEVGVNALP
IVATLTFFIGAVVAYMGATLLQSFGASVFTVDLVGLAVLREFGVLITAIMLAARSDSAFT
ASIGAMKMQQEIDAMRVLGLDPYEALVLPRVVACVLMAPLLTFGAMVAGIFGGMLVAWTA
QDISPALFFTRLHSEIDISHFWVGMSKAPVFGMVVAIIGCRQGMQVQGDVESLGRRVTAS
VVQSIFAIIVLEALFAMMYLELEI
Download sequence
Identical sequences Q0AN41
394221.Mmar10_2004 gi|114570554|ref|YP_757234.1| WP_011643941.1.83773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]