SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q0I8J4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q0I8J4
Domain Number - Region: 7-82
Classification Level Classification E-value
Superfamily YjeF N-terminal domain-like 0.00111
Family YjeF N-terminal domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q0I8J4
Sequence length 264
Comment (tr|Q0I8J4|Q0I8J4_SYNS3) Precorrin-6x reductase {ECO:0000313|EMBL:ABI47132.1} KW=Complete proteome; Reference proteome OX=64471 OS=Synechococcus sp. (strain CC9311). GN=sync_2025 OC=Synechococcus.
Sequence
MHRQENRQGTVWLLAGTGDGPHLAEVLISQGWHVHVSVVGDMAAHPYRGMALEAIHVGAL
DGSWGISQWLQTIPVDWVVDATHPFALRISDQLNQACKRSGHRLVRFERRMEASGQAVVL
GSIADLADQPLSGRQLLLALGARQLVEAAMVARKAGATVFARVLPSPLSLIQAAAAGIPS
EHLAVVRPLQGPEPGALEAAVCRRWAITDVVCRQSGGATEALWARLSMQMGFGLWLLRRP
APIAEVPVVNSVSQLLAHLNGKTP
Download sequence
Identical sequences Q0I8J4
64471.sync_2025 gi|113954823|ref|YP_731228.1| WP_011619940.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]