SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q0ICQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0ICQ1
Domain Number 1 Region: 118-221
Classification Level Classification E-value
Superfamily Cell-division inhibitor MinC, C-terminal domain 4.45e-30
Family Cell-division inhibitor MinC, C-terminal domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q0ICQ1
Sequence length 237
Comment (tr|Q0ICQ1|Q0ICQ1_SYNS3) Probable septum site-determining protein MinC {ECO:0000256|HAMAP-Rule:MF_00267} KW=Complete proteome; Reference proteome OX=64471 OS=Synechococcus sp. (strain CC9311). GN=sync_0546 OC=Synechococcus.
Sequence
MITSVALTQGTFQTACHRLVLPTNRHIPWQDTLADQLNGLEGKDLELDSGEWLLNCRVLA
AFQAQLEERQCRLLSIKSCNPHTVVSANALGIPAQLMTPQPTDPRPESREEQQAPALLIH
RATLRSGDHLKARHHVLLIGDVNPGAQISAGGNVLIWGRLRGCAHAGVQGDLNARITALQ
LRPLQLRIADLVARGPEEKPQPGLAEEARIVDGEIAIEPADPRSDLTIQELSFDLNN
Download sequence
Identical sequences Q0ICQ1
gi|113952750|ref|YP_729771.1| WP_011618501.1.57161 64471.sync_0546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]