SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q0RUU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q0RUU3
Domain Number - Region: 74-115
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.017
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q0RUU3
Sequence length 237
Comment (tr|Q0RUU3|Q0RUU3_RHOJR) Uncharacterized protein {ECO:0000313|EMBL:ABH00943.1} KW=Complete proteome; Reference proteome OX=101510 OS=Rhodococcus jostii (strain RHA1). GN=RHA1_ro11296 OC=Rhodococcus.
Sequence
MKKTTLGRSTPRHPAVLDLLGSPSTIDHPPGARTMAPGGPATPLPPPRSPLPSPRGRRLG
KNAVADIAAVAVVVAGGVAISHLRSGDSETASPAATTTPTATVAVDENGLPILNLPEPEQ
TENASASDGDCRADRGDQTSGAGVIAAFNHAYYSLRNGEAARGLATSTSSVLPGPELQKV
IDAVPIGTNYCLRTAELADGVYLVDLSVMQPAQPAKRGTQTVTTQEVDGKWYVDVFN
Download sequence
Identical sequences Q0RUU3
gi|111027123|ref|YP_709101.1|NC_008271 gi|111027123|ref|YP_709101.1| 101510.RHA1_ro11296 WP_011600568.1.78234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]