SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q0SNM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q0SNM4
Domain Number - Region: 6-103
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0811
Family DNA repair protein MutS, domain III 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q0SNM4
Sequence length 143
Comment (tr|Q0SNM4|Q0SNM4_BORAP) Flagellar protein {ECO:0000313|EMBL:AEL69515.1} KW=Complete proteome OX=390236 OS=Borrelia afzelii (strain PKo). GN=BafPKo_0289 OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borreliella.
Sequence
MNDLNFRKQKLNRILTIRTYYRKLSERNLMNINKKISKINQFSDGIPNLLKSLNSFDDLS
IRGYIDCLNYKKKQNFKILGELRKHYNECYDIYVDKYREEKKIKILIKTLNNSIIKNREK
KESLLLDEYVNYKVCQDLRIESE
Download sequence
Identical sequences Q0SNM4
WP_011600938.1.79404 WP_011600938.1.94617 gi|111115112|ref|YP_709730.1| gi|111115112|ref|YP_709730.1| 390236.BAPKO_0297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]