SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q0TTB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0TTB0
Domain Number 1 Region: 205-501
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 2.21e-119
Family AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC 0.00000312
Further Details:      
 
Domain Number 2 Region: 2-191
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 1.53e-62
Family Inosicase 0.0000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q0TTB0
Sequence length 501
Comment (sp|Q0TTB0|PUR9_CLOP1) Inosinicase {ECO:0000255|HAMAP-Rule:MF_00139} KW=Complete proteome OX=195103 OS=NCIMB 6125 / NCTC 8237 / Type A). GN=CPF_0677; OC=Clostridium.
Sequence
MKKRALISVFDKDGVLELAKFLRDRDVEIISSGGTYKYLKENNIEVKEISEITDFPEMLD
GRVKTLHPLVHAGILAIRDNKEHMKTLEEREINTIDYVVVNLYPFFEKVRENLSFEEKVE
FIDIGGPTMLRAAAKNFKDVVVLSDKKDYEKVMNEIKENNCVSFKLRKTLAGKVFNLMSA
YDAAISNFLLEGEEEYPEYLSVSYKKIQDLRYGENPHQGAAYYSSTEFDGAMNSFEILNG
KALSYNNIKDLDIAWKVACEFEETACCALKHNTPCGVAVGENSKEVYLKAYDADPVSIFG
GIVAINRKIDKATAEEMVKIFLEVVAAPDFDEDALEVLRTKKNLRVIKCKNTPQAKNYMV
TVDGGILVQGEDNKLANEYKVVTEKEPTEMELRDMIFGMKVVKYVKSNAIVVVKDGVATG
IGGGQVNRIWATKEALERGKGGAVLASDAFFPFRDCVDEAAKNGIKAIIQPGGSIRDEES
IEACNEHGISMVFTGVRHFKH
Download sequence
Identical sequences A0A1U9V5R7 Q0TTB0
195103.CPF_0677 gi|110799553|ref|YP_695130.1| IDP04407 WP_011590302.1.10161 WP_011590302.1.2058 WP_011590302.1.20964 WP_011590302.1.23119 WP_011590302.1.50147 WP_011590302.1.52260 WP_011590302.1.5234 WP_011590302.1.52659 WP_011590302.1.68380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]