SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q0TUU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0TUU6
Domain Number 1 Region: 249-410
Classification Level Classification E-value
Superfamily CinA-like 4.84e-56
Family CinA-like 0.000079
Further Details:      
 
Domain Number 2 Region: 1-204
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 1.57e-40
Family MoeA central domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q0TUU6
Sequence length 412
Comment (sp|Q0TUU6|CINA_CLOP1) Putative competence-damage inducible protein {ECO:0000255|HAMAP-Rule:MF_00226} KW=Complete proteome OX=195103 OS=NCIMB 6125 / NCTC 8237 / Type A). GN=CPF_0130; OC=Clostridium.
Sequence
MKAEIMAIGTEILLGDIVNTNAQFLAKELANLGIGVYHQSVVGDNSERILEAFDNAFKNC
DTIITTGGLGPTKDDLSKELAAKYFNMEMCLREELLCDLEDYFKKNNLEMTENNKKQCYF
PKEAIILPNPNGTAPGAILEGENNKRIILLPGPPREMEPMFTNHVVPYLSKFTDSVLVSK
ILRVFGIGESKMEDLVCDLLDNENPTVAPYAKNIDVILRITAKGKNKEEAEKLISPMEKE
IRKRLGDNIYGEGEVTLEEVVGKLLVDKKMTVSTAESCTGGMVASTLINYPGISEVFMEG
AVTYSNEAKMKRLGVKKETLEDFGAVSEECAREMAKGIAKNAGTRIGISTTGIAGPGGGT
EEKPVGLVYAGLCIDGITKVKKFNFKADRQKVRTRTMMNVLDWLRRELEKID
Download sequence
Identical sequences A0A1U9V447 Q0TUU6
195103.CPF_0130 WP_004459640.1.10161 WP_004459640.1.2058 WP_004459640.1.50147 WP_004459640.1.98368 gi|110799435|ref|YP_694594.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]