SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q0VB45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0VB45
Domain Number 1 Region: 180-376
Classification Level Classification E-value
Superfamily E set domains 4.67e-76
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000463
Further Details:      
 
Domain Number 2 Region: 71-196
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.44e-23
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q0VB45
Sequence length 425
Comment (tr|Q0VB45|Q0VB45_MOUSE) Potassium inwardly-rectifying channel, subfamily J, member 6 {ECO:0000313|EMBL:AAI20795.1} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Kcnj6 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MTMAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVR
KDGKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIR
GDMDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLG
SIVNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIR
AKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLP
KEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETY
ETSTPSLSAKELAELANRAELPLSWSVSSKLNQHAELETEEEEKNPEELTERNGDVANLE
NESKV
Download sequence
Identical sequences Q0VB45 Q54A91
NP_034736.2.92730 NP_037324.1.100692 NP_037324.1.4139 XP_021065143.1.100879 ENSMUSP00000097108 ENSMUSP00000097108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]