SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q0VN22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0VN22
Domain Number 1 Region: 16-164,213-383
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 3.79e-80
Family Acetamidase/Formamidase-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q0VN22
Sequence length 409
Comment (tr|Q0VN22|Q0VN22_ALCBS) Formamidase {ECO:0000313|EMBL:CAL17426.1} KW=Complete proteome; Reference proteome OX=393595 OS=/ SK2). GN=ABO_1978 OC=Alcanivoracaceae; Alcanivorax.
Sequence
MAETIIKIDLKQSPYENENVHNRWHPDIPMAKMVKPGDDFILECHDWTGGQIENNDSADD
VRDVDLTQVHFLTGPVGVEGAEPGDLLVVDILDIGTFDESQWGFNGFFSKQNGGGFLTEH
FPEAQKSIWDFNGMFTKSRHIPNVEFAGLIHPGLIGCLPSKEMLEEWNTREKALYDTEPD
RVPGLANLPYADTAHMGKLSGDAKAQAAAEGARTVPPREHGGNCDIKDLSRGSQVYFPVY
VKDAGLSVGDLHFSQGDGEITFCGAIEMAGWIHLRVNIIKGGMEKYGIKNPIFKPSPMAP
KYDDYLIFEGISVDEQGKQHYLDVHVAYRQACLNAIEYLKKFGYTGAQAYALLGCAPVQG
HISGVVDVPNACATLWLPTDIFDFDIKPGMDGPQHSVAGSVDIPLSKDK
Download sequence
Identical sequences Q0VN22
WP_011589257.1.14994 WP_011589257.1.41240 WP_011589257.1.66393 WP_011589257.1.75482 gi|110834839|ref|YP_693698.1| 393595.ABO_1978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]