SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q0W2R1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0W2R1
Domain Number 1 Region: 121-251
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 3.03e-26
Family MJ1460-like 0.036
Further Details:      
 
Domain Number 2 Region: 22-88
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000161
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q0W2R1
Sequence length 253
Comment (tr|Q0W2R1|Q0W2R1_METAR) Putative transcription regulator (ArsR family) {ECO:0000313|EMBL:CAJ37332.1} KW=Complete proteome; Reference proteome OX=351160 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50). GN=RCIX2213 OC=Methanocellaceae; Methanocella.
Sequence
MKNGNVQDQVPIELFATDSGIRAIDSPVLVKILAMLKEREMPFDEIVANSGKAKSTISVH
LNRMIEAGVIGSRLDPDDRRKKIFFINSSYLGGLQKEAGIDDDIRDYFTRAKGGLPDMFA
FYRLMFRAIRVELYRQGVNIEPILTDAGYKIGQALYESVRSDDLGEMLGNIARFWSDHQL
GRMVVASMDPLTIYVYDCFECADLPQLGRPACAFDIGILKAIFIARFGKDPGIKEIGCYA
MGDGRCTFVIGGQ
Download sequence
Identical sequences Q0W2R1
351160.RCIX2213 WP_012035249.1.28485 gi|147919602|ref|YP_686658.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]