SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q10WN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q10WN0
Domain Number 1 Region: 116-285
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 3.3e-61
Family NadC C-terminal domain-like 0.00000962
Further Details:      
 
Domain Number 2 Region: 7-115
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 7.46e-28
Family NadC N-terminal domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q10WN0
Sequence length 290
Comment (tr|Q10WN0|Q10WN0_TRIEI) Nicotinate-nucleotide pyrophosphorylase (Carboxylating) {ECO:0000313|EMBL:ABG53344.1} KW=Complete proteome; Reference proteome OX=203124 OS=Trichodesmium erythraeum (strain IMS101). GN=Tery_4352 OC=Microcoleaceae; Trichodesmium.
Sequence
MKGVIPPKIILDNLLKDWLLEDIGRGDRTTSGLLLEDEVIVGTGHWLIKEPGVIAGLPIA
ARVFELLDQQVNFLPTVAEGEWCEKGTVVAKLDGSLDSLLTGERVALNLGMRLSGIATMT
RKYVEKIAGLPVQLVDTRKTTPGLRILEKYATQVGGAKNHRMGLDDGVMIKDNHIAAAGG
IGEAIAKVRERIPYPLTIEVETETLVEVERALEHQADIIMLDNMSVEVMEQAVKMIRQNN
SRIKIEASGNITLETIRNVAETGVDYISTSAPITRSTWLDLSMKITKAVS
Download sequence
Identical sequences Q10WN0
WP_011613670.1.43450 gi|113477756|ref|YP_723817.1| 203124.Tery_4352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]