SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q10YA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q10YA8
Domain Number 1 Region: 84-353
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 9.9e-76
Family BC ATP-binding domain-like 0.00000152
Further Details:      
 
Domain Number 2 Region: 2-114
Classification Level Classification E-value
Superfamily PreATP-grasp domain 9.35e-47
Family BC N-terminal domain-like 0.0000204
Further Details:      
 
Domain Number 3 Region: 332-446
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 2.93e-46
Family BC C-terminal domain-like 0.00003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q10YA8
Sequence length 451
Comment (tr|Q10YA8|Q10YA8_TRIEI) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha / biotin carboxylase {ECO:0000313|EMBL:ABG52766.1} KW=Complete proteome; Reference proteome OX=203124 OS=Trichodesmium erythraeum (strain IMS101). GN=Tery_3707 OC=Microcoleaceae; Trichodesmium.
Sequence
MRFSKILIANRGEIALRILRTCEEIGIATIAVHSTIDCHALHVQLADEAVCIGEPTSSKS
YLNIPNIISAALTRDATAIHPGYGFLAENARFAEICADHDITFIGPSPAGIRAMGDKSTA
KETMQKAGVPTVPGSDGLLTDENEAVAIAEKIGFPLIIKATAGGGGRGMRLVRHPNDLSK
LFQAAQGEAEAAFGNPGVYMEKFIERPRHIEFQILADSYGNVIHLGERDCSIQRRHQKLL
EEAPSPALDPKLRQKMGEAAVKAAKSINYLGAGTVEFLLDQSGKFYFMEMNTRIQVEHPV
TEAITGLDLIAEQIRIAQGEKLQLTQKQVKFNGHAIECRINAEDPEHNFRPHPGRISGYL
PPGGPGVRMDSHVYTDYEIPPYYDSLIGKLIVWGHNRPTAIQRMKRALRECAVTGVPTTI
GFHQRILETPEFVDGEVYTNFVENIMNQDPK
Download sequence
Identical sequences Q10YA8
203124.Tery_3707 gi|113477178|ref|YP_723239.1| WP_011613097.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]