SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q10Z86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q10Z86
Domain Number 1 Region: 132-237
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.61e-16
Family FHA domain 0.0045
Further Details:      
 
Weak hits

Sequence:  Q10Z86
Domain Number - Region: 3-26
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0683
Family Rubredoxin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q10Z86
Sequence length 239
Comment (tr|Q10Z86|Q10Z86_TRIEI) FHA domain containing protein {ECO:0000313|EMBL:ABG52438.1} KW=Complete proteome; Reference proteome OX=203124 OS=Trichodesmium erythraeum (strain IMS101). GN=Tery_3335 OC=Microcoleaceae; Trichodesmium.
Sequence
MYITCETCGYDNNPTDAEYCEACGAELKSTSPAIIEQNQPITTPKVIPMTPSGPELAVTT
CQACGYDNNPIDAEYCGACGAELKSIAATTIQTNPTITTPKFIPITPSGPGLESTSAIPT
PSLSTTISPARLVAKQPNVPQSEFPLNNVAVVGVFDPDSGPVDIDLESFLGGETVSRQHA
EIYPEYGHWMVKDLGSLNGIFIKPSGQTRFGARITTPMNLNPGDEIAFGKVQFVFRLGS
Download sequence
Identical sequences Q10Z86
gi|113476850|ref|YP_722911.1| WP_011612783.1.43450 203124.Tery_3335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]