SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q112K0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q112K0
Domain Number 1 Region: 117-299,434-589
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.98e-109
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000433
Further Details:      
 
Domain Number 2 Region: 296-429
Classification Level Classification E-value
Superfamily GAD domain-like 1.1e-36
Family GAD domain 0.00074
Further Details:      
 
Domain Number 3 Region: 1-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.07e-32
Family Anticodon-binding domain 0.00008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q112K0
Sequence length 595
Comment (sp|Q112K0|SYDND_TRIEI) Non-discriminating aspartyl-tRNA synthetase {ECO:0000255|HAMAP-Rule:MF_00044} KW=Complete proteome; Reference proteome OX=203124 OS=Trichodesmium erythraeum (strain IMS101). GN=Tery_2354; OC=Microcoleaceae; Trichodesmium.
Sequence
MRTHYCGQVNSNNIEETVNLCGWVDRRRDHGGVIFLDLRDRSGLIQIVSDPERTPDSYQI
AGDIRNEYVVQITGRVSRRPEESLNPKLPTGEIEIYADDIQLLNGLGKQLPFQVSTAETE
AVREELRLKYRYLDLRRERMTRNLLLRHEVIKAIRRFLEDEQNFVEIETPILTRSTPEGA
RDYLVPSRVHPGEWFALPQSPQLFKQILMVSGFDRYYQIARCFRDEDLRADRQPEFTQLD
MEMSFMSQEEILQLNEKLVAYIFQKVKGIDLPLPFPRLTYTEAMERYGSDKPDVRFGLEL
VDVSDLMKDSGFKVFSGAIAKGGIVKVLPIPGGNDAISNVRIKPGGDLFKEASEVGAKGL
AYVRVKEGGKIDTIGAIKDNLTDEQKQELLKRTNAQPGHLLLFAADDANTVNKTLDRLRL
VIGEQLGLIDQDKISLLWVTDFPMFEWNEDEQRLEALHHPFTAPHPDDINDLKTARAQAY
DLVFNGYEVGGGSLRIYQRDVQEKVFEAIGLSAQEADNKFGFLLEAFEYGTPPHGGIAYG
LDRLVMLLAVEESIRDVIAFPKTQQAKCLLANAPSEVDKKQLKELHVSSISKAKS
Download sequence
Identical sequences Q112K0
gi|113475986|ref|YP_722047.1| WP_011611941.1.43450 203124.Tery_2354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]