SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q11TT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q11TT5
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.33e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q11TT5
Sequence length 127
Comment (tr|Q11TT5|Q11TT5_CYTH3) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome; Reference proteome OX=269798 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469). GN=CHU_1913 OC=Cytophaga.
Sequence
MKYTVEKTEKYVLFQLHEEKLTSITAPDLKTELVTLNAEGFNNIILNMTDVKYADSSGLS
SILIGNRVCNNSGGLFVMCNVNDHVMKLLKISQLDTILTLLPTVEEGIDAVFLHEIQGDL
EDEESAE
Download sequence
Identical sequences Q11TT5
gi|110638312|ref|YP_678521.1| WP_011585296.1.19587 WP_011585296.1.79486 269798.CHU_1913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]