SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q12U51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q12U51
Domain Number 1 Region: 1-179
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.97e-55
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q12U51
Sequence length 180
Comment (tr|Q12U51|Q12U51_METBU) Pyruvate synthase gamma chain {ECO:0000313|EMBL:ABE53025.1} KW=Complete proteome; Reference proteome OX=259564 OS=ACE-M). GN=Mbur_2155 OC=Methanosarcinaceae; Methanococcoides.
Sequence
MKEIRIHGRGGQGSVTAAELLAVAAFADGKFSQAFPAFGVERRGAPVQAFTRINDDPIRL
RAQVYEPDYVIVQDPTLLEVVDVESGAKDDGVILINSDFEPEHFDLNTNAKIMTVNATKI
ALDIIGRPIVNTVLLGAFAGASGLIDPESIKNAVKERFPGKIGEKNAEAIQKAYDMMTEA
Download sequence
Identical sequences Q12U51
gi|91774083|ref|YP_566775.1| 259564.Mbur_2155 WP_011500163.1.71292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]