SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q13TS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q13TS1
Domain Number 1 Region: 16-287
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 3.3e-97
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000175
Further Details:      
 
Domain Number 2 Region: 357-443
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 1.7e-16
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0011
Further Details:      
 
Domain Number 3 Region: 288-332
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000000118
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q13TS1
Sequence length 459
Comment (tr|Q13TS1|Q13TS1_PARXL) Cytochrome b {ECO:0000256|RuleBase:RU003385} KW=Complete proteome; Reference proteome OX=266265 OS=Paraburkholderia xenovorans (strain LB400). GN=Bxe_A0415 OC=Burkholderiaceae; Paraburkholderia.
Sequence
MAIEHEVETTGLVGWIDRRFPLTSTWKKHVSEYYAPKNFNFWYFFGSLALLVLVNQVVTG
IFLTMNYKPDATLAFSSVEYIMREVPWGWLIRYMHSTGASMFFVVVYLHMFRGLMYGSYR
KPRELVWIFGCAIFLCLMAEAFFGYLLPWGQMSFWGAQVIVNLFSAIPFIGPDLSLWIRG
DYVVSDVTLNRFFAFHVIAIPLVLIGLVIAHLVALHEVGSNNPDGIEIKAKKDPDGIPLD
GIPFHPYYSVHDFMGVTVFLLIFAAIIFFAPEMGGYFLEANNFVPANPLQTPPEIAPVWY
FTAFYAMLRATTDPFKIVLMVVIALLGLLALVRARGKWRLGLPVLAVLVILAMAFTESKF
WGVVVMGSAVVSLFFLPWLDRSPVKSIRYRPFFHKVFYGIFVAAFLTLAFLGTKPPSPAA
TLIAQICALIYFAFFLGMPFWTRLGTFKQPPERVRFKPH
Download sequence
Identical sequences Q13TS1
266265.Bxe_A0415 WP_011489980.1.38508 WP_011489980.1.45576 gi|91785364|ref|YP_560570.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]