SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q149E9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q149E9
Domain Number 1 Region: 282-339
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.18e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Weak hits

Sequence:  Q149E9
Domain Number - Region: 242-288
Classification Level Classification E-value
Superfamily ARM repeat 0.0038
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q149E9
Sequence length 339
Comment (tr|Q149E9|Q149E9_MOUSE) Transcription initiation factor IIA subunit 1 {ECO:0000313|Ensembl:ENSMUSP00000068562} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Gtf2a1 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHQHQQAQPQQTVPQ
QAQTQQVLIPASQQATAPQVIVPDSKLLQHMNASSITSAAATAATLALPAGVTPVQQLLT
NSGQLLQVVRAANGAQYILQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQT
GVIIQPQQILFTGNKTQVIPTTVAAPAPAQAPMPAAGQQQPQAQPAQQQAPLVLQVDGTG
DTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVC
QYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
Download sequence
Identical sequences Q149E9
NP_780544.1.92730 ENSMUSP00000068562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]