SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q15555 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q15555
Domain Number 1 Region: 44-173
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-49
Family Calponin-homology domain, CH-domain 0.000000574
Further Details:      
 
Domain Number 2 Region: 243-303
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 2.09e-19
Family EB1 dimerisation domain-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q15555
Sequence length 327
Comment (sp|Q15555|MARE2_HUMAN) End-binding protein 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MAPRE2; OC=Catarrhini; Hominidae; Homo.
Sequence
MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSR
HDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKL
LQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIP
PPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDL
ETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYAS
EEHEGHTEEPEAEEQAHEQQPPQQEEY
Download sequence
Identical sequences A0A024RC33 Q15555
NP_055083.1.87134 NP_055083.1.92137 9606.ENSP00000300249 ENSP00000300249 ENSP00000300249 gi|10346135|ref|NP_055083.1| Q15555 hsi002005850.1 ENSP00000300249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]