SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q155Q3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q155Q3
Domain Number 1 Region: 14-152
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.16e-32
Family Calponin-homology domain, CH-domain 0.00083
Further Details:      
 
Domain Number 2 Region: 600-678
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.58e-22
Family DIX domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q155Q3
Sequence length 683
Comment (sp|Q155Q3|DIXC1_HUMAN) DIX domain-containing protein 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=DIXDC1; OC=Catarrhini; Hominidae; Homo.
Sequence
MLACLTRGNLLDVLQEGFNEQQLQAYVAWVNAQLKKRPAVKPVQDLRQDLRDGVILAYLI
EIVAGEKLSGVQLSPGNQQEMKNNVEKVLQFVASKKIRMHQTSAKDIVDGNLKSIMRLVL
ALAAHFKPGSSRTVNQGRDSRAPLQSHRPHCATAVAQGAAAALADVCHDMSRSGRDVFRY
RQRNSSMDEEIENPYWSVRALVQQYEGQQRSPSESSCSSLTSPSPIHSAKSESIITQSEE
KADFVIIPAEGIENRTEGTDSPLSRDWRPGSPGTYLETSWEEQLLEQQEYLEKEMEEAKK
MISGLQALLLNGSLPEDEQERPLALCEPGVNPEEQLIIIQSRLDQSMEENQDLKKELLKC
KQEARNLQGIKDALQQRLTQQDTSVLQLKQELLRANMDKDELHNQNVDLQRKLDERNRLL
GEYKKELGQKDRLLQQHQAKLEEALRKLSDVSYHQVDLERELEHKDVLLAHCMKREADEA
TNYNSHNSQSNGFLLPTAGKGATSVSNRGTSDLQLVRDALRSLRNSFSGHDPQHHTIDSL
EQGISSLMERLHVMETQKKQERKVRVKSPRTQVGSEYRESWPPNSKLPHSQSSPTVSSTC
TKVLYFTDRSLTPFMVNIPKRLEEVTLKDFKAAIDREGNHRYHFKALDPEFGTVKEEIFH
DDDAIPGWEGKIVAWVEEDHGEN
Download sequence
Identical sequences Q155Q3
ENSP00000461149 ENSP00000394352 ENSP00000461149 NP_001033043.1.87134 NP_001033043.1.92137 gi|83816971|ref|NP_001033043.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]