SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q16595 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q16595
Domain Number 1 Region: 86-197
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.92e-36
Family Frataxin-like 0.000000782
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q16595
Sequence length 210
Comment (sp|Q16595|FRDA_HUMAN) m81-FXN KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FXN; OC=Catarrhini; Hominidae; Homo.
Sequence
MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQR
GLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTF
EDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGV
SLHELLAAELTKALKTKLDLSSLAYSGKDA
Download sequence
Identical sequences A0A0S2Z3G4 Q16595
HR6778 NP_000135.2.87134 NP_000135.2.92137 gi|31077081|ref|NP_000135.2| 9606.ENSP00000366482 ENSP00000366482 ENSP00000366482 ENSP00000366482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]