SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q16C31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q16C31
Domain Number 1 Region: 459-572
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.94e-16
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q16C31
Sequence length 581
Comment (tr|Q16C31|Q16C31_ROSDO) Sulfate transporter, permease protein, putative {ECO:0000313|EMBL:ABG30462.1} KW=Complete proteome; Reference proteome OX=375451 OS=sp. (strain OCh 114)) (Roseobacter denitrificans). GN=RD1_0783 OC=Rhodobacteraceae; Roseobacter.
Sequence
MDRTMTHPLRRYMPVFDWGRTYDRKAFSNDMIAAVIVTIMLIPQSLAYALLAGLPPEAGI
YASIAPIVLYALFGTSRALAVGPVAVVSLLTASAIGQVAEQGTAGYAIAALTLAFLSGGF
LVLMGVFRLGFLANFLSHPVIAGFITASGILIATSQLKHILGVSAHGHTLPEILLAIGAH
LNEVNWITVIIGATATAFLFWVRKGLKPFLTRLGASATMADIATKAGPVVAVVGTTVAVW
AFDLAGQGVKIVGEVPQSLPPLTLPGFSLDLLQALLVPAILISIIGFVESVSVAQTLAAK
KRQCINPDQELIGLGAANLGAAFTGGYPVTGGFARSVVNFDAGAETPAAGAFTAIGLAIA
AVSLTPLVFFLPNATLAATIIVAVLSLVDLSILKKTWAYSRADFTAVAATIVLTLTLGVE
VGVAAGVITSVLLHLYKTSRPHVAEVGRVPGSEHFRNILRHEVETDPRVLCLRVDESLYF
VNARFLEDLIQSRVIEGCSIAHVVLMFSAVNEVDYSALESLEAVNARLKDMDVGLHLSEV
KGPVMDRLKRSHLIDDLNGQIFLSQNDAWTTLADHPRAAAE
Download sequence
Identical sequences Q16C31
gi|110678141|ref|YP_681148.1| 375451.RD1_0783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]