SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q16NL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q16NL8
Domain Number - Region: 88-153
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00968
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q16NL8
Sequence length 247
Comment (tr|Q16NL8|Q16NL8_AEDAE) AAEL011936-PA {ECO:0000313|EMBL:EAT35942.1} KW=Complete proteome; Reference proteome OX=7159 OS=Aedes aegypti (Yellowfever mosquito) (Culex aegypti). GN=AAEL011936 OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence
MMKLVILGLLACSQVVLSNPIGEPSAAQPQDLDELAVLTEFDRLFNQLHYDIDYKLRIYR
MNHSRDLKNLNAQFISRYGFVITDIQHKKQQVKDAILEHALDIGDTQNPCIVEKNDEAIR
RATQAARDLSVAAEKIYGDMATITRVYFYPIVKDFQQTSSEFQWAVLEVLSRDNAVTGLQ
LALADLSFKYMANANMVNRVVDNLDYELEGFQDIINSLRRGAFKEIDDIGRNYVFNMEQL
LTDALTC
Download sequence
Identical sequences Q16NL8
7159.AAEL011936-PA AAEL011936-PA XP_001662085.1.48696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]