SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1AU46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1AU46
Domain Number 1 Region: 117-195
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.19e-25
Family Translational machinery components 0.00016
Further Details:      
 
Domain Number 2 Region: 46-113
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.2e-19
Family Ribosomal S5 protein, N-terminal domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q1AU46
Sequence length 200
Comment (sp|Q1AU46|RS5_RUBXD) 30S ribosomal protein S5 {ECO:0000255|HAMAP-Rule:MF_01307} KW=Complete proteome; Reference proteome OX=266117 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129). GN=Rxyl_2138; OC=Rubrobacteraceae; Rubrobacter.
Sequence
MGRPRTSQTRGQGPSGATGGNPRGGGSTTRERDARGARPGERDGGSEIQDRVVQIRRVAK
VKKGGRRLNFSALVVVGDGQGRVGVGLGKANTVPAAIAKGQEKARHAMFDVPMRNTTIPH
EVVGEYESSRVLLKPASEGTGVIAGGGVRAVLELAGIKDVLTKALGSTTPVNLVRATEDG
LRQLRTKAQIEQIRGVKVRL
Download sequence
Identical sequences Q1AU46
gi|108804957|ref|YP_644894.1| 266117.Rxyl_2138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]