SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1AZE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1AZE1
Domain Number 1 Region: 5-135
Classification Level Classification E-value
Superfamily AF1862-like 3.66e-35
Family Cas Cmr5-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q1AZE1
Sequence length 141
Comment (tr|Q1AZE1|Q1AZE1_RUBXD) CRISPR-associated protein, Cmr5 family {ECO:0000313|EMBL:ABG03237.1} KW=Complete proteome; Reference proteome OX=266117 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129). GN=Rxyl_0260 OC=Rubrobacteraceae; Rubrobacter.
Sequence
MAEERTLEQRRAAHALAAIQELQRAGRGGYGNYKSYVSSLPATILTNGLGQAAATLLAGA
KLNSKNRNADNRAREKLYDHLSSWLCGGDEESPYQKKGDLLENITRNDQDCYIRAQAEAL
EYLSWLKRFAEAFLEGSKGEK
Download sequence
Identical sequences Q1AZE1
gi|108803112|ref|YP_643049.1| 266117.Rxyl_0260 WP_011563255.1.70533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]