SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1CPB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q1CPB3
Domain Number - Region: 9-38
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0144
Family NfeD domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q1CPB3
Sequence length 56
Comment (tr|Q1CPB3|Q1CPB3_STRPF) Phage protein {ECO:0000313|EMBL:ABF37804.1} KW=Complete proteome OX=370554 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750). GN=MGAS10750_Spy0854 OC=Streptococcus.
Sequence
MRKYIEFKDEWKSAADHLNDFIDKNKYAKVTGDLWQGSDQVIAEQCFLKVLEEMQK
Download sequence
Identical sequences A0A0H2UVG2 Q1CPB3 Q1CQ27 Q48SE0 Q938M0
gi|28895534|ref|NP_801884.1| gi|16271796|ref|NP_438133.1| gi|28876356|ref|NP_795565.1| NP_438133.1.24609 Q938M0_9CAUD gi|94994250|ref|YP_602348.1| gi|71903922|ref|YP_280725.1| gi|21910778|ref|NP_665046.1| gi|94990327|ref|YP_598427.1| gi|94990845|ref|YP_598945.1| 193567.SPs0622 198466.SpyM3_1242 319701.M28_Spy1260 370552.MGAS10270_Spy0818 370552.MGAS10270_Spy1336 370554.MGAS10750_Spy0854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]