SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1ECI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1ECI2
Domain Number 1 Region: 44-102
Classification Level Classification E-value
Superfamily DNA-binding domain 1.57e-20
Family GCC-box binding domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q1ECI2
Sequence length 192
Comment (sp|Q1ECI2|ERF23_ARATH) Ethylene-responsive transcription factor ERF023 KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=ERF023; OC=Arabidopsis.
Sequence
MSPQRMKLSSPPVTNNEPTATASAVKSCGGGGKETSSSTTRHPVYHGVRKRRWGKWVSEI
REPRKKSRIWLGSFPVPEMAAKAYDVAAFCLKGRKAQLNFPEEIEDLPRPSTCTPRDIQV
AAAKAANAVKIIKMGDDDVAGIDDGDDFWEGIELPELMMSGGGWSPEPFVAGDDATWLVD
GDLYQYQFMACL
Download sequence
Identical sequences Q1ECI2
NP_563624.1.80155 AT1G01250.1 3702.AT1G01250.1-P AT1G01250.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]