SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1GI52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1GI52
Domain Number 1 Region: 139-422
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.4e-125
Family Enolase 0.0000000176
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.65e-58
Family Enolase N-terminal domain-like 0.00000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q1GI52
Sequence length 425
Comment (sp|Q1GI52|ENO_RUEST) 2-phosphoglycerate dehydratase {ECO:0000255|HAMAP-Rule:MF_00318} KW=Complete proteome; Reference proteome OX=292414 OS=Ruegeria sp. (strain TM1040) (Silicibacter sp.). GN=TM1040_0931; OC=Rhodobacteraceae; Ruegeria.
Sequence
MSTIIDIHAREILDSRGNPTVEVDVVLEDGTMGRAAVPSGASTGAYEAVEKRDGDKSRYM
GKGVLEAVAAVNGEIADELVGFDATEQVSIDRAMIELDGTENKGRLGANAILGVSMAVAK
AAADFTTQPLYRYVGGAAARILPVPMMNIINGGEHADNPIDIQEFMIMPVAAENIRDAVR
MGSEVFHTLKKELSAAGLSTGIGDEGGFAPNIASSREALDFILKSIEKAGYKPGEEIYLA
LDCAATEYYKDGKYVLSGEGKTLTSEENAAYLAALVNDYPIISIEDGMSEDDWDGWKALT
DQIGDKVQLVGDDLFVTNPVRLAEGIERGCANSMLVKVNQIGSLTETLQAVDMAHRARYT
NVMSHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEETLGEIAEYAGR
SILKG
Download sequence
Identical sequences Q1GI52
gi|99080772|ref|YP_612926.1| WP_011538274.1.15988 292414.TM1040_0931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]