SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1GY03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1GY03
Domain Number 1 Region: 83-149
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 6.93e-29
Family CO dehydrogenase ISP C-domain like 0.00077
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 8.65e-24
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q1GY03
Sequence length 153
Comment (tr|Q1GY03|Q1GY03_METFK) (2Fe-2S)-binding protein {ECO:0000313|EMBL:ABE50884.1} KW=Complete proteome; Reference proteome OX=265072 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875). GN=Mfla_2620 OC=Methylophilaceae; Methylobacillus.
Sequence
MVTLDINGESRQLDVPNEMPLLWAIRDVAQLTGTKFGCGMALCGACTIHLDSEPVRACVT
PVSAAVGKKITTVEAVGEDKVGKAVQAAWLELGVAQCGYCQAGQIMSATALLRSTLHPTD
EDIDEAMSGNICRCGTYPRIRAAIKLAAKEGAK
Download sequence
Identical sequences Q1GY03
WP_011480837.1.99167 gi|91776969|ref|YP_546725.1| 265072.Mfla_2620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]