SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1ITS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1ITS7
Domain Number 1 Region: 86-275
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.31e-66
Family B3/B4 domain of PheRS, PheT 0.00000914
Further Details:      
 
Domain Number 2 Region: 348-565
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.34e-45
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0001
Further Details:      
 
Domain Number 3 Region: 573-663
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 2.09e-19
Family Anticodon-binding domain of PheRS 0.002
Further Details:      
 
Domain Number 4 Region: 288-356
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.38e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.0013
Further Details:      
 
Domain Number 5 Region: 1-75
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000238
Family Domains B1 and B5 of PheRS-beta, PheT 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q1ITS7
Sequence length 671
Comment (tr|Q1ITS7|Q1ITS7_KORVE) Phenylalanyl-tRNA synthetase beta subunit {ECO:0000256|HAMAP-Rule:MF_00283} KW=Complete proteome; Reference proteome OX=204669 OS=Koribacter versatilis (strain Ellin345). GN=Acid345_0718 OC=Candidatus Koribacter.
Sequence
MRILPNWIRDFVDTKANDHDLAESLTHAGIAVESIVEEHGHTIYEMDLTTNRVDAMNHYG
VAREASAIFDIELKPVTPKLPKAEGTAKFAIELEDAQGCPRYTARIVRGVKVASSPKNIA
QRLELLGSRAINNIADASNYALFEIGHPTHAFDLDTLEGGKIVVRRAREGETLKTLDGET
RKLTSQDLVIADAVKAVALAGVMGGFDTMITEKTTNVLIESAWFDPASIRHTAKRLGMHT
DASHRYERGADIAITALACDRVAELILETAGGKLEGEKIDAIARKIEPRTVQLRRSEVKR
HLGLDLPEQEIERILRRLGFGVDGETVTIPSWRLDVEREIDVIEELARIHGYNNFPNTLP
SFAGGVIELPDEQKRARVREILLALGYNEAISLTFASKEDAAQFGGGEPLAIANPLNEEQ
GYLRTSLLPGMLGMIAYNLNRGNTDVRLFESGDVFEKTGERFEERRRLCFAATGNSIEAS
VHTKAKATDFFDLKGDVEDLLAAFTKRTVYFDTLVPEYYHPGRAARIVLDGATVGYVGQL
HPSVADVRKLKQDVYLAEILQERLFQHDLKAPRFTAISRYPAVERDFSFVFDDAVTFDRV
REAVEALGITEMTSFQAVEIFRGGSVPAGKYSFLVRAAFQSAERTLRDEEVANWSGQIIK
ALEILGGALRG
Download sequence
Identical sequences Q1ITS7
WP_011521525.1.86553 204669.Acid345_0718 gi|94967749|ref|YP_589797.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]