SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1IX70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1IX70
Domain Number 1 Region: 6-230
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.64e-62
Family G proteins 0.0000000431
Further Details:      
 
Domain Number 2 Region: 309-404
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 8.63e-36
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000403
Further Details:      
 
Domain Number 3 Region: 216-312
Classification Level Classification E-value
Superfamily Translation proteins 3.93e-31
Family Elongation factors 0.00000616
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q1IX70
Sequence length 405
Comment (sp|Q1IX70|EFTU_DEIGD) Elongation factor Tu {ECO:0000255|HAMAP-Rule:MF_00118} KW=Complete proteome; Reference proteome OX=319795 OS=Deinococcus geothermalis (strain DSM 11300). GN=Dgeo_1869; OC=Deinococcaceae; Deinococcus.
Sequence
MAKGTFERTKPHVNVGTIGHVDHGKTTLTAAITFTAAAMDPTVEKLAYDQIDKAPEEKAR
GITINTAHVEYNTPARHYSHVDCPGHADYVKNMITGAAQMDGAILVVSSADGPMPQTREH
ILLARQVGVPYIVVFMNKVDMVDDEELLELVEMEVRELLSKYEFPGDDLPVIKGSALQAL
EALQQNPKTARGENPWVDKIWELLDAIDAYIPTPERATDKTFLMPVEDVFTITGRGTVAT
GRVERGVCKVGDEVEIVGLRDTKKTTITGVEMHRKLLDQGMAGDNVGVLLRGVARDDVER
GQVLAKPGSITPHTKFEASVYVLSKDEGGRHSAFFGGYRPQFYFRTTDVTGVVELPAGVE
MVMPGDNVSFTVELIKPIAMEEGLRFAIREGGRTVGAGVVTKVLE
Download sequence
Identical sequences Q1IX70
gi|94984753|ref|YP_604117.1| gi|94985969|ref|YP_605333.1| 319795.Dgeo_0646 319795.Dgeo_1869 WP_011529789.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]