SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1IY12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1IY12
Domain Number 1 Region: 314-409
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.29e-26
Family Cold shock DNA-binding domain-like 0.0015
Further Details:      
 
Domain Number 2 Region: 247-333
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.59e-26
Family Cold shock DNA-binding domain-like 0.0012
Further Details:      
 
Domain Number 3 Region: 404-491
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.12e-23
Family Cold shock DNA-binding domain-like 0.002
Further Details:      
 
Domain Number 4 Region: 54-168
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.19e-19
Family Cold shock DNA-binding domain-like 0.012
Further Details:      
 
Domain Number 5 Region: 160-240
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000131
Family Cold shock DNA-binding domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q1IY12
Sequence length 587
Comment (tr|Q1IY12|Q1IY12_DEIGD) RNA binding S1 {ECO:0000313|EMBL:ABF45872.1} KW=Complete proteome; Reference proteome OX=319795 OS=Deinococcus geothermalis (strain DSM 11300). GN=Dgeo_1577 OC=Deinococcaceae; Deinococcus.
Sequence
MEDQTQTPATEGGTTQPMPGTEQTSSGQTSSGQTPSQPQAAPASTDEREYPAMTMEDVLA
SEAQEPQTVSRGDIVDGTVVFIGQEGIAVDVGAKVEGIIPLNQIGDEPVTLEQAQQMYKP
GDQIEAYVVRVDLANNQIVLSKKRADQDKGWRVLERMQEQDEAFEVEVLEKVRGGLVAQV
EGIRAFLPASQVDTRRVNDLDPYVGKPLMVKLIELNRKRNRVIISHRAILEAQKAKAREQ
TIGKLVPGAQFEGEVVEITDFGVFVNLGGIDGLVHRSELTYGRFNHPRDVVKVGDKVQVQ
VIDVDEGRERINLSMKSLTQDPWEGAVEKYHIGQRVRGKVTNLTNFGAFVELEPGLEGLV
HVSEMSWTKRVRHPNEVLKEGDEVEAVILRIDPKERRISLGIRQTTDDPWSALPDRYPPG
TPVKGKITGMTDFGVFMEIEEGIEGLIHISELDTQRVNNPADLFKKGDEIEAVILNIDPV
EQRASLSRRRALGGGGPVRDYVSQGGGSRSDRYSGGGGQGGRSGGRGGRSGGADYNYNAK
DAQQGGKISTKLGDVYADLFAQFGLGGDNKKDSAQGEGQGNTEKQGE
Download sequence
Identical sequences Q1IY12
gi|94985677|ref|YP_605041.1| 319795.Dgeo_1577 WP_011530706.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]