SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1IY61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1IY61
Domain Number 1 Region: 19-328
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 6.58e-52
Family Zn metallo-beta-lactamase 0.099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q1IY61
Sequence length 331
Comment (tr|Q1IY61|Q1IY61_DEIGD) Beta-lactamase-like protein {ECO:0000313|EMBL:ABF45823.1} KW=Complete proteome; Reference proteome OX=319795 OS=Deinococcus geothermalis (strain DSM 11300). GN=Dgeo_1528 OC=Deinococcaceae; Deinococcus.
Sequence
MTAPDLALSRVHGTLHALQVPIPYPMKTVTVLIDTGGSTGGPVTLIDTALDTPEAREAIE
NGLAALGLHWPDVERVIITHHHPDHYGLAGVVEERSGASVQMLDVEIGRGERYWHLWEEW
LPGHTKHMQDNGLPPELVATLGQESRRTRARVHPASRVQPLREGQMVPLAGGDWEVLWLP
GHADGHLGLWNPAENLLIAGDAILPRISPNVGLYAYTRPDPLGDYLQTLGKLEALNPARA
VVGHHGPVMEGVQARARQLRDHHHERLDFIRAEATREPRSAYDLSLAMFPRDLNTAGRRF
ALAETLAHAEHLHLLGQLARTWQGDRWVYHG
Download sequence
Identical sequences Q1IY61
WP_011530657.1.71355 319795.Dgeo_1528 gi|94985628|ref|YP_604992.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]