SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1J0J4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1J0J4
Domain Number 1 Region: 3-432
Classification Level Classification E-value
Superfamily L-aspartase-like 4.4e-123
Family L-aspartase/fumarase 0.00000000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q1J0J4
Sequence length 435
Comment (tr|Q1J0J4|Q1J0J4_DEIGD) Adenylosuccinase {ECO:0000256|RuleBase:RU361172} KW=Complete proteome; Reference proteome OX=319795 OS=Deinococcus geothermalis (strain DSM 11300). GN=Dgeo_0688 OC=Deinococcaceae; Deinococcus.
Sequence
MIDRYLTPEMKLLWSEASRYRAWLKVELAAMEAQARQGEVPREAFEALSTRAAADPLDEA
FAVRVAEIEAVTRHDIVAFTRALTERYGEEARFIHHGLTSTDVVDTAQNLLLDEALNIIQ
EDVRALREVCRTQAVTHKHTPVVGRTHGIHAEPMTFGLKFLNWMATLDRDLERLHAARER
IRVVMLSGSVGTYAHISPRIEEEVAAAWGWQPAPITNQTLARDRHAEVLAALAILGTTLE
KIAVEIRHLQRSEVREAMEPFGQGQTGSSSMPHKKNPILTENVTGLSRLLRGHLVTGLEN
VALWHERDISHSSAERVILPDATAAASYATRRLTGVLRDLVVFPERMLRNLNDLGGLVFS
QRVLHALIDEKGLSREAAYDLVQRNALRSWETGEGLRDLLRADPTNPLSEAELDAAFDLG
WYLRHVEDIYARFGL
Download sequence
Identical sequences Q1J0J4
319795.Dgeo_0688 gi|94984795|ref|YP_604159.1| WP_011529831.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]