SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1J0P4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1J0P4
Domain Number 1 Region: 1-69
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.84e-22
Family Cold shock DNA-binding domain-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q1J0P4
Sequence length 87
Comment (tr|Q1J0P4|Q1J0P4_DEIGD) Cold-shock DNA-binding domain protein {ECO:0000313|EMBL:ABF44940.1} KW=Complete proteome; Reference proteome OX=319795 OS=Deinococcus geothermalis (strain DSM 11300). GN=Dgeo_0638 OC=Deinococcaceae; Deinococcus.
Sequence
MAVGKVKWFNAEKGYGFIETEGSEDVFAHFSAIQAQGFKKLNEGDEVEFEIEPGQRGKGP
QARNIVVTKAAPAPAYGDRPARRNDRW
Download sequence
Identical sequences Q1J0P4
gi|94984745|ref|YP_604109.1| 319795.Dgeo_0638 WP_011529781.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]