SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1J0Q7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1J0Q7
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.5e-17
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q1J0Q7
Sequence length 218
Comment (tr|Q1J0Q7|Q1J0Q7_DEIGD) Glycolate oxidase subunit, GlcE {ECO:0000313|EMBL:ABF44927.1} KW=Complete proteome; Reference proteome OX=319795 OS=Deinococcus geothermalis (strain DSM 11300). GN=Dgeo_0625 OC=Deinococcaceae; Deinococcus.
Sequence
MPILDLSPGDQTVTVSGDTPLLEVYAALPAGLFPPFPPVELPGGVGGLVARGGFAQTFFF
GAEVLGVTFRAPSGRVIRAGGRTVKNVQGYDLTRPFVGSFGRLGEALDVTLRLRPGPRAQ
HVAASGSLEALGPLSARFAWQDGEDVHLLHFGHAREVERALAVLPGAREVEEPLDLTARF
PGGIGVGEGALRDRRFGWVNGGAAPPVPPLFARLAASL
Download sequence
Identical sequences Q1J0Q7
gi|94984732|ref|YP_604096.1| WP_011529768.1.71355 319795.Dgeo_0625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]