SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1J1R1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1J1R1
Domain Number 1 Region: 205-306
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000445
Family Multidrug resistance efflux transporter EmrE 0.017
Further Details:      
 
Domain Number 2 Region: 66-157
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000102
Family Multidrug resistance efflux transporter EmrE 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q1J1R1
Sequence length 309
Comment (tr|Q1J1R1|Q1J1R1_DEIGD) Permease of the drug/metabolite transporter (DMT) superfamily {ECO:0000313|EMBL:ABF44573.1} KW=Complete proteome; Reference proteome OX=319795 OS=Deinococcus geothermalis (strain DSM 11300). GN=Dgeo_0270 OC=Deinococcaceae; Deinococcus.
Sequence
MYAKVGPEGATLERVTVTPAPAAPPTTVRAGLGLALVAALGFSTLGIWGKLAGRVGLDSF
SVLAWRFGLVALALLPLAGRELTWRQRRPLLGVGLLYALATTCYFGALSRITAGATGLLL
YLAPAFVILFAWLLGRRPDAAKLGAVALAALGLGLVVGIPGAGDRDPLGLGLGAGAGALY
AAYLLASERWLSGVPPLASTGHMALVAGLYFAALAAGTGTLHVPTTAAQWGVIVGMAALA
TLVAVPALYGAVERLGAARASLIGTLEPLFTVLLTFLILAEPLRPAVLLGGALILAGAVL
AQRGNRSAP
Download sequence
Identical sequences Q1J1R1
319795.Dgeo_0270 WP_011529418.1.71355 gi|94984378|ref|YP_603742.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]