SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1J2N3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1J2N3
Domain Number 1 Region: 98-264
Classification Level Classification E-value
Superfamily SIS domain 4.45e-32
Family mono-SIS domain 0.0048
Further Details:      
 
Domain Number 2 Region: 11-82
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000118
Family RpiR-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q1J2N3
Sequence length 290
Comment (tr|Q1J2N3|Q1J2N3_DEIGD) Transcriptional regulator, RpiR family {ECO:0000313|EMBL:ABF44251.1} KW=Complete proteome; Reference proteome OX=319795 OS=Deinococcus geothermalis (strain DSM 11300). GN=Dgeo_2822 OC=Deinococcaceae; Deinococcus.
Sequence
MATPPAHLPPVLRRLHLLREEQGAATVRVIDQILMDPERFLSLTIAELSEAAGTSDATVV
RLVQHLGFGGYQEFKLQLSRALAVSRKADLTVEPQDASVTILRKIFDSSNTALDDTLEHL
NLEAFSAAVQAMTLARHIELIGMGASGVVALSGQYRGLRLGLSCRASTDPGTFLSTCSLL
EPTDVLIAVSFSGTRPQVVQAARLARQAGAIVVALTGLGRTPLSKVVHHTLTVSAPGDRY
RPEGLATQIPQVAILDALFTSLHVAQDPYLSERLSRAAAARRALNAEPSP
Download sequence
Identical sequences Q1J2N3
gi|94972285|ref|YP_594325.1| WP_011525757.1.71355 gi|94972285|ref|YP_594325.1|NC_008010 319795.Dgeo_2822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]