SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1J2S8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1J2S8
Domain Number 1 Region: 400-489
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000903
Family Anti-sigma factor antagonist SpoIIaa 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q1J2S8
Sequence length 499
Comment (tr|Q1J2S8|Q1J2S8_DEIGD) Sulphate transporter {ECO:0000313|EMBL:ABF44206.1} KW=Complete proteome; Reference proteome OX=319795 OS=Deinococcus geothermalis (strain DSM 11300). GN=Dgeo_2773 OC=Deinococcaceae; Deinococcus.
Sequence
MTVHSPRFDLRQYQREWFANPRKDVLAGIVVALALIPEAIAFSIIAGVDPQVGLYASFII
ALITAFLGGRPGMISAATGAMALLMTGLVKDHGIQYLFAATVLTGVLQVVFGWAKLARYL
KFVPRSVMVGFVNALAILIFMAQLPQFVGANWQMYAMVAAGLAIIYLLPLVFKAMPSALV
AIVVLTVVAVVTGADVKTVGDMGTLPTALPHFQFPQVPLTFETLAIIFPVALTLSLVGLL
ESLLTAQLIDERTDTTSDKNVESRGQGVANIVTGFFGGMAGCAMIGQSMINVTSGGRGRL
STFVAGAFLMVLILALQPLLVQIPMAALVAVMMVVAISTFDWGSLRTLTVFPKGETVVML
ATVAVTVFTHDLSLGVLIGVVLSALFFARKVSQLSQVTPVDEVDGTRTYRVRGQLFFVST
HDFLHQFDFTHPARRVVIDLSDAHFWDGSAVGALDKVMLKFMRQGTSVELRGLNAASATL
VERLAVHDKPDALDRMGGH
Download sequence
Identical sequences Q1J2S8
gi|94972240|ref|YP_594280.1|NC_008010 gi|94972240|ref|YP_594280.1| 319795.Dgeo_2773 WP_011525799.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]