SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1J329 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1J329
Domain Number 1 Region: 240-384
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.1e-42
Family NPCBM-like 0.00031
Further Details:      
 
Domain Number 2 Region: 88-230
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.57e-37
Family NPCBM-like 0.00021
Further Details:      
 
Domain Number 3 Region: 483-649
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.23e-27
Family YxiM N-terminal domain-like 0.0066
Further Details:      
 
Domain Number 4 Region: 390-471
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00000000000000322
Family Invasin/intimin cell-adhesion fragments 0.0078
Further Details:      
 
Domain Number 5 Region: 782-918,957-1003,1040-1055
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000000131
Family Soluble quinoprotein glucose dehydrogenase 0.02
Further Details:      
 
Weak hits

Sequence:  Q1J329
Domain Number - Region: 683-842
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.0144
Family Soluble quinoprotein glucose dehydrogenase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q1J329
Sequence length 1193
Comment (tr|Q1J329|Q1J329_DEIGD) Glycosyl hydrolase family 98, carbohydrate binding module {ECO:0000313|EMBL:ABF44105.1} KW=Complete proteome; Reference proteome OX=319795 OS=Deinococcus geothermalis (strain DSM 11300). GN=Dgeo_2672 OC=Deinococcaceae; Deinococcus.
Sequence
MVQRKPSTSALRLGLACALALGAVACSTPQSHPDANDPVAAYPYLPGVDYSWADVPKTAD
PYPGGQGYPWHGLALAATSTPTDLGLTTDLKWDSASSGYGPVELNKSNNTKTGGDGQTLT
IGGQTYALGLGAHANSDIRYTLPGDCATFTATVGVDDEVGNLGSVVFQVWDGTTTKLYDS
GVLRGSDGPKEITVPLTRSDGTAVRNLRLVVTDAGDGISYDHADWAMPKVLSCTVPQASG
DKFLSDLPTATPPVNGYGPYELDTSNGERLGGDGRPLTIGGTTYRKGLGVHAASELVYDL
GGNCSTFTAEVGVDDEVGDRGSVVFQVFADGTELFNSGVRTGKDPALAVNQSVAGKKQLK
LVVSGTADGISYDHADWANAKISCSVIQPTVSSVTVNPATLNMSVNGTQQLTAEVKGSGA
FDPGVTWTTSDAKVATVSSSGLVTALAPGSVTVTATSNFDPSKSGSSQITVTSTPTLPDG
GVLINFQPASSAAPAGYTKDTGAAYDASRGFGWIREDSVGTGSSVPLDITPNTRDRALVG
VDARLNTLIHMQLPASNTTSTGVKIPAAWEYALPNGIYTVTVAVGDASNVYDSAHQINIE
GQLAIPRFTPTATKKFVTTTLRANVTDGRLTIDARGGSNTKIDYVTIQPGNRPSARSISP
QDGQTMVSTTTPITVDLNLPNSAIDDNTFTPSAVRLIDAGTNVAVSALCETSGGGDVIVC
QPNQPLQANTKYIFEITDGVKDTSGAAFLPVRTSFVTGASGSSTGDVAFEQVALSNAPAM
SYTSVEIGPDGKLYAATLSGEILRFGILPDGTVTPPEVIKSVQQANGGPRTIIGLKFDPA
STADNLVLWISNNAFWDGRTTPPDWSGKITRLSGPNLEKVQDYVVGLPRSNQDHMTNSIS
FRPGEPNALYVLQGSNSAMGAPDTAWGNRPERLLNAALLRVDLSKITTPPLDVKTAEGGL
YNPYAPGAPVTIYASGIRNAYDMVWHTNGQLYVPTNGSAAGGNTPGTPTPLPDSCRTRPD
GAYTGPAVPALSSVGVQHDFLFRVTPGGYYGHPNPQRCEWVLNGGNPTANVDPGEVPEYP
VGTLPDRNWKGFAYDFGEHASANGVIEEYSSAPITSLKNTLLVVRYSAGKDIIVLTPGGP
NQDIVKAQTGIVGLTNFNPSPLDLTEDRTNGHLYVAQLDQRTGAGKLTLLRLK
Download sequence
Identical sequences Q1J329
WP_011525898.1.71355 319795.Dgeo_2672 gi|94972139|ref|YP_594179.1| gi|94972139|ref|YP_594179.1|NC_008010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]