SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1L9A0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1L9A0
Domain Number 1 Region: 53-455
Classification Level Classification E-value
Superfamily Ras GEF 6.15e-93
Family Ras GEF 0.0009
Further Details:      
 
Domain Number 2 Region: 524-586
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.54e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0018
Further Details:      
 
Domain Number 3 Region: 453-524
Classification Level Classification E-value
Superfamily EF-hand 0.000000036
Family Calmodulin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q1L9A0
Sequence length 687
Comment (tr|Q1L9A0|Q1L9A0_DANRE) Si:dkey-12o15.1 {ECO:0000313|EMBL:AAI71384.1} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=si:dkey-12o15.1 OC=Cyprinidae; Danio.
Sequence
MGFDTMNRKESKSSRKSRQEGGIKSRRPVQRRMTCPSAQEISRALQSPPAHASFRSASLD
ELILRCLHCFDSDGKLNRGTQLVSMTLMMHNWVVPSHIFAHKLLSLYKDCPAEKRGQRRP
QICHFIRQWISQFRLMFEMDPLLEKAMGDLWALVSAEGTNSHHQLINTPYINPPVNISQT
PSPLVKKRKVSLLFDHMEPDEMAEHLSYLEFKNFCNVSFLDYRSYVVHGSVRDNPALERS
VMLCNGVSQWVQLMILNRHTSQQRAEVFTKFIHVAQKLRSLQNFNTLMAVIGGLCHSSIS
RLKDTASLLSSDVTKTLSELTELLSSYSNYSNYRRVYSECTGFKVPILGVHLKDLISLNE
ALPDYLEDDKINLGKLQHLYSNISDLLAIHDCTPPFEANKDLLHLLTLSLDLYYTEDEIY
ELSYAKEPKNPKIQPVAPVKPPVVAEWGSGVTPRLDPATISKHVKQMVDSIMKNYDLNMD
GYISLEEFEKIAANFPFSFCTHESDREGEISREEITSYFMRGMSVCAKLGFNLHNLHNFH
ETTYKRPTFCDTCGGFLWGVIKQGYHCKDCGVNCHKHCKDVVGMECLKRLQVNSSSCPCT
PGPVSGLHTKGNSWTFQSGSEEEAFVFPNGNESEHSKGQTSSDSDAEAATLSDRSTQTEP
GVWTPVAKRKDRLHSQKQHPPLEKVLP
Download sequence
Identical sequences Q1L9A0
ENSDARP00000082937 ENSDARP00000119563 ENSDARP00000082937 NP_001038327.1.45394 7955.ENSDARP00000082937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]