SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1MS53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1MS53
Domain Number 1 Region: 222-339
Classification Level Classification E-value
Superfamily TPR-like 3.5e-17
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q1MS53
Sequence length 359
Comment (tr|Q1MS53|Q1MS53_LAWIP) FOG: TPR repeat {ECO:0000313|EMBL:CAJ54172.1} KW=Complete proteome; Reference proteome OX=363253 OS=Lawsonia intracellularis (strain PHE/MN1-00). GN=LI0116 OC=Desulfovibrionaceae; Lawsonia.
Sequence
MNEVSVGIEDGDSIACQKQWGYFSIITYILLFFLIFSPSITIAKEPILEVTYTIPYHAHL
VTEPVIQIAEAATKLHALEQTRSNFTSNLAVKLELRTREQQLALASAIYFVSIHERTVLD
GPKLSIKAHVYPSSEKILDDHIRQLLRQQDHLQLRLLAVNQLEQYINEGVELLNQAHLCS
SADIRCKHDDSLVPKIKRTSNRIKALELFLVELNDFEHVWANPEKSVLTFSEATALDPDN
SLLWLGVGECLVLLNRPYESIKAFQKVMIKNNIPARTLYMRGIAHLQMYLPGLAIKDISQ
ALQLEPEHPSWWRALGTAKLVAGDTVAMCADFYQACAMGDCEGLAEVREQNFCLVSPEF
Download sequence
Identical sequences A0A1S8C0R5 Q1MS53
WP_011526199.1.40060 WP_011526199.1.91582 WP_011526199.1.98040 gi|94986561|ref|YP_594494.1| gi|442555375|ref|YP_007365200.1| 363253.LI0116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]