SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1PF11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q1PF11
Domain Number - Region: 158-218
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0195
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q1PF11
Sequence length 552
Comment (tr|Q1PF11|Q1PF11_ARATH) Zinc-finger domain of monoamine-oxidase A repressor R1 {ECO:0000313|EMBL:AEC07462.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=F26B6.18 OC=Arabidopsis.
Sequence
MLTMRTEAQDSVPKSNPNPELIKETPKVSLYEQCREERIKENLQRMNNLGLLNLSRKLKP
KTRPVKRSYGNRNSVQNPTPPLQPSRRSSRLENTTPVIYTDGINEKGKKASKRESVVIGE
GIRAEIYTEEHEKLLGNTERSWTCFVDGYDKNGKRIYDPFNGKTCHQCRQKTMGHRTQCS
ECNLVQGQFCGDCLFMRYGEHVLEALENPDWICPACRGICNCSLCRNNKGWVPTGPIYRR
IAALGYKSVAHYLIQTKRAPTDDTTPSQASAKRSLSFQEKIAGDEDVPMLENDDSLQKEE
GENTNEDQNGDLPEEVQKVQNMECQSGGSLKKEEDETPNSARRSLSFLLPSVEDDQTSLV
DVQVLSCLVPPKQEHSCAHNGDDLPDIQERIGQHSNLETKPDSYLLHVDEQIPLVDVQVL
SYLETPKQEHSCAHIGDGLPKIQEWIGQDPTSETKPVSYLIPIDDDQTSLVDAQVMYLET
PKQDKQEHSCAHIGDDLPEIQQGTGQDSNLETRLGESQTLVVKARVTRSKRKAALEPNPD
SIGGRLRQRRRT
Download sequence
Identical sequences Q1PF11
3702.AT2G23530.1-P AT2G23530.1 AT2G23530.1 NP_179934.2.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]