SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q1QP92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1QP92
Domain Number 1 Region: 461-563
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.16e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q1QP92
Sequence length 583
Comment (tr|Q1QP92|Q1QP92_NITHX) Sulphate transporter {ECO:0000313|EMBL:ABE61955.1} KW=Complete proteome; Reference proteome OX=323097 OS=Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14). GN=Nham_1108 OC=Bradyrhizobiaceae; Nitrobacter.
Sequence
MSIADGRPHQIRKPTFAELFTPKLVTVLREGYRGADFRADVVAGLTVAIVALPLSMAIAI
ASGATPDRGLTTAIIGGFFVSLLGGSRFQVGGPAGAFIVLVALTVERHGIDGVILATAMA
GVLLIAAGLLRLGTYIKFIPYPVTVGFTAGIAVIIFASQIKDFLGITLAKEPSQLVPKLE
ALARAGDTVSMSAVAVSVIAVVIIAGLKRFRPAWPGMLIAIVVTAVAAWALSLPVETIGT
RFGGIPRELSWPAWPAFSLDKVQAVFPDAVAFALLASIESLLSAVVADGMTGRRHRSNCE
LMAQGVANVASALFGGLCVTGLIARTATNIRAGARGPVAGMLHSAFLLLFMLIAAPLASY
IPLAALAAVLAVVAWNMVEKHEFATLIRASRGDAVVLLATFLLTVFRGLTEGILVGFALG
AVLFIHRMAQITGIEANVPLAAEDRADDANGDRQPYDAAMVSDPDVVIYRITGAFFFGAA
SEVGSVLDAIMERQKAFVVDFAAVPFLDSTAANAISRVAAKARRQGVSFFITGASPVVRR
ALLTHGVRPPRATFRETIARAVADIKAARHAPPIAAIDAQPAP
Download sequence
Identical sequences Q1QP92
WP_011509650.1.12189 323097.Nham_1108 gi|92116686|ref|YP_576415.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]