SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q28QM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q28QM9
Domain Number 1 Region: 5-126
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.85e-24
Family Sfri0576-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q28QM9
Sequence length 135
Comment (tr|Q28QM9|Q28QM9_JANSC) Uncharacterized protein {ECO:0000313|EMBL:ABD54983.1} KW=Complete proteome; Reference proteome OX=290400 OS=Jannaschia sp. (strain CCS1). GN=Jann_2066 OC=Rhodobacteraceae; Jannaschia.
Sequence
MSTQIYETIEQIPTTAPNVYAFRVTGHIDDDASEALAKFMLAAFDRHEEKVDMLLDLTAF
TGSDWDSMLDGDVIKSRFRSLSEVRRYAVIGAPDRAAKMIEFMDKIIPVEAKAFDANQKD
AAWAFVGASEASVSV
Download sequence
Identical sequences Q28QM9
gi|89054557|ref|YP_510008.1| WP_011455187.1.50977 372825 290400.Jann_2066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]