SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2FSC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2FSC2
Domain Number 1 Region: 91-204
Classification Level Classification E-value
Superfamily Fe,Mn superoxide dismutase (SOD), C-terminal domain 1.83e-39
Family Fe,Mn superoxide dismutase (SOD), C-terminal domain 0.00000865
Further Details:      
 
Domain Number 2 Region: 6-92
Classification Level Classification E-value
Superfamily Fe,Mn superoxide dismutase (SOD), N-terminal domain 2.88e-27
Family Fe,Mn superoxide dismutase (SOD), N-terminal domain 0.0000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q2FSC2
Sequence length 206
Comment (tr|Q2FSC2|Q2FSC2_METHJ) Superoxide dismutase {ECO:0000256|RuleBase:RU000414} KW=Complete proteome; Reference proteome OX=323259 OS=100397 / JF-1). GN=Mhun_2974 OC=Methanospirillaceae; Methanospirillum.
Sequence
MDDSKKYTLPALSFEYGALAPFITEKQLTLHHQKHHQAYVTGANAIFEKLEMARREGGDL
DQKALLKELSFHIGGHRLHTLFWENLAPAGKGGGGVPSGILADWINRDFGSLDRFKKEFT
QTASSVEGSGWAVLSVCLGTQRLLLMQVEKHNVHVYPGFRILMVLDVWEHAYYLDYMNDR
AKFIENFWNIIRWDMVNQRLEAALKS
Download sequence
Identical sequences Q2FSC2
gi|88604202|ref|YP_504380.1| 323259.Mhun_2974 WP_011449914.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]