SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q2FTU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2FTU5
Domain Number 1 Region: 580-809
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.09e-25
Family Protein kinases, catalytic subunit 0.001
Further Details:      
 
Weak hits

Sequence:  Q2FTU5
Domain Number - Region: 475-529
Classification Level Classification E-value
Superfamily TPR-like 0.00215
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q2FTU5
Sequence length 829
Comment (tr|Q2FTU5|Q2FTU5_METHJ) Serine/threonine protein kinase {ECO:0000313|EMBL:ABD41928.1} KW=Complete proteome; Reference proteome OX=323259 OS=100397 / JF-1). GN=Mhun_2223 OC=Methanospirillaceae; Methanospirillum.
Sequence
MSSHSFFILLFFIFISFLIITPVCCVDQGSISGITFQGGEYSSDSIPDVMYPGQNGQYMV
EFRNTGMTAWEHDVEKIGVEYSGDSNLITVDPPLQLLPKGSRVHTGQSYQFPFLISAHNV
GQVKLAFAVVRLLPSGKTNRISDPVFLSMEITTGLPHNDQNSGSIQVTAGPLHVPVELDG
MPAGLTPLTLPHIPVGIHHVVVKGKEGVMESDIEVKPNSIHSITYSPEKSGVLIETKESL
LLENSNPVLTLILSNFFIILGVIITLTTVAVISIVVISGEIKRIKFVVSHVLPSSVQKES
GRDFAIETRRRISSDDVRFDPVAGLFKQGDKKSLKLKITNMGTKPIVVDTIRIEPGVCRI
VFREIFDDDPGDCEVSQAVSYIDGNGKEKSRVIHLQYRIMPRDLDLSWFFERFIQKKGNI
IAILKIKNNNPFPLEADSILLASGEERGIELVMDVPDSDELSVYKKLRILTENEYSFPLS
VKIPYNKGIFLFFSKKYSESLEWFNQQIDLGNDDGTLKRYRDLIKRKMDSSSEVNTMDSS
DIRDHEPDVKRKVDAQEGNATQVSLSPSLTGFPDSLLPIYKPSALISTDRLGIMYRALRA
ADNIEVAVRVLDSGVIPASQVELQIQAWRSLKHMNIMQIKFWERDPVYFLEFDLPSGAIQ
SKKRIYSLADLKVPIPARAALRIVRGLAEGIDYIHRQGVRHYLLEPSVIFLDDGLQPKIS
GFDTSALIQSGIPDDCWVIAPEQRNPEKFGNPGKKTDIYQVGAIFYYLLSGQVLNCFESI
SSLPSHFRSDYGVYDPIIKKSVHIDKNERYGDIREMIHEIDTLLQTFKK
Download sequence
Identical sequences Q2FTU5
WP_011449186.1.85653 323259.Mhun_2223 gi|88603469|ref|YP_503647.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]