SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q2GGF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2GGF8
Domain Number 1 Region: 530-1028
Classification Level Classification E-value
Superfamily ALDH-like 1.83e-125
Family ALDH-like 0.000000244
Further Details:      
 
Domain Number 2 Region: 179-522
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.53e-106
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000132
Further Details:      
 
Domain Number 3 Region: 8-177
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 3.01e-59
Family N-terminal domain of bifunctional PutA protein 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q2GGF8
Sequence length 1044
Comment (tr|Q2GGF8|Q2GGF8_EHRCR) L-glutamate gamma-semialdehyde dehydrogenase {ECO:0000256|PIRNR:PIRNR000197} KW=Complete proteome; Reference proteome OX=205920 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas). GN=ECH_0667 OC=Anaplasmataceae; Ehrlichia.
Sequence
MISALQTPNEIRRRMQMLYRIEENSCTRYLTEKTEISQDSKIRIYSVAKQIIERIRVDRN
LGIIDAFMQEYGLSNEEGIALMCLAESLLRIPDDCTINDLIKDKIGNSMWSNHIGSSSSM
FVNAATWGLFIGGKVLKDSNDSTRWFGTINNLLKTMGEPIIRKAVQQAMCILGKHFIKGR
DITEALNNRREGELYSFDILGEAAKTRKDAERYFTEYMAAVDSIGKSKVNNEIGNLIDYD
EISVKISALHSRYEFSQIDKVLDEIVDKLLQICKLAKEHNIRVCVDAEEASRLEISLMIL
EKLRFDSSLNGWEGLGLAVQAYQKRAFSVLDFVEDISVRSHHKMMVRLVKGAYWDYEIKN
AQELGLSSYPVFTRKVYTDVSYLACANKILSKPNTFSPCFATHNAYTLAAILEMANKDHP
GFEFQRLHGMGANLYEYVTQELAANVKCRVYAPVGSYQDLLPYLIRRLLENGANSSFINQ
LNDSNVSLEQLIEDPLEKARELEYLPHPSIPLPKDIFGPERLNSMGIDITDSVTLTNFNE
EMKNYQTCKFKAAPIIGGKELDGNFIEVFSPTNSEDIIGEVLFTDTAQALSALDMAYNAF
KDWSNIPVSTRAAILEKAANLIEENKAKLIMLLIREGGKVISDAIAEIREAVDFLRYYAV
LGRQELEQSRKLPGPVGEDNYLYFRSRGVFVCISPWNFPLAIFVGPIAAALVTGNTVLAK
PAEQTSIIAYETVKLLHDAGVPKEVLHLLLGSGKELGEALLRNEKIGGVAFTGSTETARI
INQSIAEKEGGIIPFIAETGGLNTMITDTSALIEQVTNDVITSAFKSAGQRCSALRVLFV
QEEVADKQIEMICGAMEDLVVGDPMLLKTDIGPVIDKASQEMLIAHEDRMSREAKLLYKV
KLGEDCEKGYFFAPCVYEIQSISQLKREVFGPILHIIRYKKGDLHRILDEINSTGYGLTF
AVQSRVQSNIDVIIDSVNVGNVYVNRNQVGAVVGVQPFGGQGLSGTGPKAGGPYYLHRFL
TEKVVSINTTALGGNTTLMCLTDQ
Download sequence
Identical sequences Q2GGF8
WP_011452748.1.20904 WP_011452748.1.31359 WP_011452748.1.42435 WP_011452748.1.42678 WP_011452748.1.56909 WP_011452748.1.68154 gi|88657803|ref|YP_507475.1| 205920.ECH_0667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]